Recombinant Human RPP25L Protein (1-163 aa), GST-tagged
Cat.No. : | RPP25L-2149H |
Product Overview : | Recombinant Human RPP25L Protein (1-163 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-163 aa |
Description : | May be a component of ribonuclease P or MRP. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 44.6 kDa |
AA Sequence : | MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | RPP25L ribonuclease P/MRP subunit p25 like [ Homo sapiens (human) ] |
Official Symbol | RPP25L |
Synonyms | RPP25L; C9orf23; bA296L22.5; |
Gene ID | 138716 |
mRNA Refseq | NM_148178 |
Protein Refseq | NP_680544 |
UniProt ID | Q8N5L8 |
◆ Recombinant Proteins | ||
RPP25L-4793H | Recombinant Human RPP25L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPP25L-5220H | Recombinant Human RPP25L Protein, GST-tagged | +Inquiry |
RPP25L-663Z | Recombinant Zebrafish RPP25L | +Inquiry |
RPP25L-2149H | Recombinant Human RPP25L Protein (1-163 aa), GST-tagged | +Inquiry |
Rpp25l-5597M | Recombinant Mouse Rpp25l Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPP25L-7936HCL | Recombinant Human C9orf23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPP25L Products
Required fields are marked with *
My Review for All RPP25L Products
Required fields are marked with *