Recombinant Human RPS24 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | RPS24-4074H |
Product Overview : | RPS24 MS Standard C13 and N15-labeled recombinant protein (NP_148982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S24E family of ribosomal proteins. It is located in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia. |
Molecular Mass : | 15.1 kDa |
AA Sequence : | MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | RPS24 ribosomal protein S24 [ Homo sapiens (human) ] |
Official Symbol | RPS24 |
Synonyms | RPS24; ribosomal protein S24; 40S ribosomal protein S24; S24; DBA3; DKFZp686N1586; |
Gene ID | 6229 |
mRNA Refseq | NM_033022 |
Protein Refseq | NP_148982 |
MIM | 602412 |
UniProt ID | P62847 |
◆ Recombinant Proteins | ||
RPS24-255H | Recombinant Human ribosomal protein S24, His-tagged | +Inquiry |
RPS24-4820R | Recombinant Rat RPS24 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS24-5180H | Recombinant Human RPS24 protein, GST-tagged | +Inquiry |
RPS24-4019R | Recombinant Rhesus monkey RPS24 Protein, His-tagged | +Inquiry |
RPS24-3836R | Recombinant Rhesus Macaque RPS24 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS24-2167HCL | Recombinant Human RPS24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS24 Products
Required fields are marked with *
My Review for All RPS24 Products
Required fields are marked with *
0
Inquiry Basket