Recombinant Human RPS24 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RPS24-4074H
Product Overview : RPS24 MS Standard C13 and N15-labeled recombinant protein (NP_148982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S24E family of ribosomal proteins. It is located in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia.
Molecular Mass : 15.1 kDa
AA Sequence : MNDTVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RPS24 ribosomal protein S24 [ Homo sapiens (human) ]
Official Symbol RPS24
Synonyms RPS24; ribosomal protein S24; 40S ribosomal protein S24; S24; DBA3; DKFZp686N1586;
Gene ID 6229
mRNA Refseq NM_033022
Protein Refseq NP_148982
MIM 602412
UniProt ID P62847

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPS24 Products

Required fields are marked with *

My Review for All RPS24 Products

Required fields are marked with *

0
cart-icon