Recombinant Human RPS6KA4, His-tagged
Cat.No. : | RPS6KA4-29913TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 269-572 of Human MSK2 / RSK-B isoform 2 with a N terminal His tag; Pred MWt 34kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 269-572 a.a. |
Description : | This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and c-fos. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 166 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPFFQGLDWVA LAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPG SPPPGDPRIFQGYSFVAPSILFDHNNAVMTDGLEAPGA GDRPGRAAVARSAMMQQYELDLREPALGQGSFSVCRRCRQ RQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVN LHEVHHDQLHTYLVLELLRGGELLEHIRKKRHFSESEA SQILRSLVSAVSFMHEEAGVVHRDLKPENILYADDTPG APVKIIDFGFARLRPQSPGVPMQTPCFTLQYAAP |
Gene Name | RPS6KA4 ribosomal protein S6 kinase, 90kDa, polypeptide 4 [ Homo sapiens ] |
Official Symbol | RPS6KA4 |
Synonyms | RPS6KA4; ribosomal protein S6 kinase, 90kDa, polypeptide 4; ribosomal protein S6 kinase, 90kD, polypeptide 4; ribosomal protein S6 kinase alpha-4; MSK2; RSK B; |
Gene ID | 8986 |
mRNA Refseq | NM_001006944 |
Protein Refseq | NP_001006945 |
MIM | 603606 |
Uniprot ID | O75676 |
Chromosome Location | 11q11-q13 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Insulin Signaling, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; |
Function | ATP binding; magnesium ion binding; mitogen-activated protein kinase p38 binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RPS6KA4-3846R | Recombinant Rhesus Macaque RPS6KA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS6KA4-14496M | Recombinant Mouse RPS6KA4 Protein | +Inquiry |
RPS6KA4-4029R | Recombinant Rhesus monkey RPS6KA4 Protein, His-tagged | +Inquiry |
RPS6KA4-7793M | Recombinant Mouse RPS6KA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS6KA4-6718Z | Recombinant Zebrafish RPS6KA4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS6KA4-2160HCL | Recombinant Human RPS6KA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS6KA4 Products
Required fields are marked with *
My Review for All RPS6KA4 Products
Required fields are marked with *
0
Inquiry Basket