Recombinant Human RRAD protein, His-tagged
Cat.No. : | RRAD-2818H |
Product Overview : | Recombinant Human RRAD protein(39 - 141 aa), fused to His tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 39 - 141 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RRAD Ras-related associated with diabetes [ Homo sapiens ] |
Official Symbol | RRAD |
Synonyms | RRAD; Ras-related associated with diabetes; GTP-binding protein RAD; RAD; REM3; ras associated with diabetes; RAS (RAD and GEM) like GTP binding 3; RAD1; |
Gene ID | 6236 |
mRNA Refseq | NM_001128850 |
Protein Refseq | NP_001122322 |
MIM | 179503 |
UniProt ID | P55042 |
◆ Recombinant Proteins | ||
Rrad-5618M | Recombinant Mouse Rrad Protein, Myc/DDK-tagged | +Inquiry |
RRAD-1676HFL | Recombinant Full Length Human RRAD Protein, C-Flag-tagged | +Inquiry |
RRAD-1679H | Recombinant Human RRAD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RRAD-2818H | Recombinant Human RRAD protein, His-tagged | +Inquiry |
RRAD-10186Z | Recombinant Zebrafish RRAD | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RRAD Products
Required fields are marked with *
My Review for All RRAD Products
Required fields are marked with *