Recombinant Human RSPO1 Protein, His-tagged
Cat.No. : | RSPO1-422H |
Product Overview : | Recombinant human RSPO1 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 263 |
Description : | This gene encodes a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | RSPO1 R-spondin 1 [ Homo sapiens (human) ] |
Official Symbol | RSPO1 |
Synonyms | RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1; |
Gene ID | 284654 |
mRNA Refseq | NM_001038633 |
Protein Refseq | NP_001033722 |
MIM | 609595 |
UniProt ID | Q2MKA7 |
◆ Recombinant Proteins | ||
RSPO1-4342H | Recombinant Human RSPO1 protein, GMP Grade, Animal-Free, For Organoid Culture | +Inquiry |
RSPO1-5825H | Recombinant Human RSPO1 Protein (Arg31-Ala263), C-His tagged | +Inquiry |
RSPO1-671H | Active Recombinant Human RSPO1, Fc-tagged | +Inquiry |
RSPO1-499Z | Recombinant Zebrafish RSPO1 | +Inquiry |
RSPO1-1029H | Active Recombinant Human RSPO1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO1-1918HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
RSPO1-001HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
RSPO1-001MCL | Recombinant Mouse RSPO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPO1 Products
Required fields are marked with *
My Review for All RSPO1 Products
Required fields are marked with *
0
Inquiry Basket