Recombinant Human RSPO3 Protein, Fc/His-tagged
Cat.No. : | RSPO3-441H |
Product Overview : | Recombinant Human RSPO3 fused with Fc/His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Description : | This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 56.3kD |
AA Sequence : | QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | RSPO3 R-spondin 3 [ Homo sapiens ] |
Official Symbol | RSPO3 |
Synonyms | RSPO3; R-spondin 3; R spondin 3 homolog (Xenopus laevis) , thrombospondin, type I, domain containing 2 , THSD2; R-spondin-3; FLJ14440; R-spondin 3 homolog; roof plate-specific spondin-3; protein with TSP type-1 repeat; thrombospondin, type I, domain containing 2; thrombospondin type-1 domain-containing protein 2; PWTSR; THSD2; CRISTIN1; |
Gene ID | 84870 |
mRNA Refseq | NM_032784 |
Protein Refseq | NP_116173 |
MIM | 610574 |
UniProt ID | Q9BXY4 |
◆ Recombinant Proteins | ||
RSPO3-442H | Active Recombinant Human RSPO3 Protein | +Inquiry |
RSPO3-2455H | Recombinant Human RSPO3, GST-tagged | +Inquiry |
RSPO3-423H | Recombinant Full Length Human R spondin 3 Protein, His tagged | +Inquiry |
RSPO3-441H | Recombinant Human RSPO3 Protein, Fc/His-tagged | +Inquiry |
RSPO3-3883H | Active Recombinant Human RSPO3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPO3-1906HCL | Recombinant Human RSPO3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPO3 Products
Required fields are marked with *
My Review for All RSPO3 Products
Required fields are marked with *
0
Inquiry Basket