Recombinant Human RSPO3 Protein, Fc/His-tagged

Cat.No. : RSPO3-441H
Product Overview : Recombinant Human RSPO3 fused with Fc/His tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Description : This gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 56.3kD
AA Sequence : QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name RSPO3 R-spondin 3 [ Homo sapiens ]
Official Symbol RSPO3
Synonyms RSPO3; R-spondin 3; R spondin 3 homolog (Xenopus laevis) , thrombospondin, type I, domain containing 2 , THSD2; R-spondin-3; FLJ14440; R-spondin 3 homolog; roof plate-specific spondin-3; protein with TSP type-1 repeat; thrombospondin, type I, domain containing 2; thrombospondin type-1 domain-containing protein 2; PWTSR; THSD2; CRISTIN1;
Gene ID 84870
mRNA Refseq NM_032784
Protein Refseq NP_116173
MIM 610574
UniProt ID Q9BXY4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RSPO3 Products

Required fields are marked with *

My Review for All RSPO3 Products

Required fields are marked with *

0
cart-icon
0
compare icon