Recombinant Human RTCB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RTCB-6278H
Product Overview : C22orf28 MS Standard C13 and N15-labeled recombinant protein (NP_055121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : RTCB (RNA 2',3'-Cyclic Phosphate And 5'-OH Ligase) is a Protein Coding gene. Diseases associated with RTCB include Oropharyngeal Anthrax. Among its related pathways are tRNA processing and Gene Expression. Gene Ontology (GO) annotations related to this gene include RNA ligase (ATP) activity.
Molecular Mass : 55.2 kDa
AA Sequence : MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RTCB RNA 2',3'-cyclic phosphate and 5'-OH ligase [ Homo sapiens (human) ]
Official Symbol RTCB
Synonyms RTCB; RNA 2',3'-cyclic phosphate and 5'-OH ligase; FAAP; HSPC117; C22orf28; DJ149A16.6; RNA-splicing ligase RtcB homolog; 3'-phosphate/5'-hydroxy nucleic acid ligase; ankyrin repeat domain 54; focal adhesion-associated protein; tRNA-splicing ligase RtcB homolog; EC 6.5.1.8
Gene ID 51493
mRNA Refseq NM_014306
Protein Refseq NP_055121
MIM 613901
UniProt ID Q9Y3I0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTCB Products

Required fields are marked with *

My Review for All RTCB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon