| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
110-405 a.a. |
| Description : |
This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Conjugation : |
HIS |
| Tissue specificity : |
Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested |
| Form : |
Lyophilised:Reconstitution with 159 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
QDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGAC VEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAG GSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRT HDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTAS GTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEE PLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDE VTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIM KIETPAPRKPPQALAKQGSLYHEMAI |
| Sequence Similarities : |
Contains 1 PH domain.Contains 1 REM (Hr1) repeat. |