Recombinant Human RTKN, His-tagged
Cat.No. : | RTKN-27495TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 110-405 (296 amino acids) of Human RTKN with an N terminal His tag. Predicted MWt: 33 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 110-405 a.a. |
Description : | This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Tissue specificity : | Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested |
Form : | Lyophilised:Reconstitution with 159 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGAC VEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAG GSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRT HDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTAS GTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEE PLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDE VTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIM KIETPAPRKPPQALAKQGSLYHEMAI |
Sequence Similarities : | Contains 1 PH domain.Contains 1 REM (Hr1) repeat. |
Gene Name | RTKN rhotekin [ Homo sapiens ] |
Official Symbol | RTKN |
Synonyms | RTKN; rhotekin; B5; |
Gene ID | 6242 |
mRNA Refseq | NM_001015055 |
Protein Refseq | NP_001015055 |
MIM | 602288 |
Uniprot ID | Q9BST9 |
Chromosome Location | 2p13.1 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem; |
Function | GTP binding; GTP-Rho binding; GTPase inhibitor activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RTKN-8057H | Recombinant Human RTKN protein, His & GST-tagged | +Inquiry |
RTKN-4851R | Recombinant Rat RTKN Protein, His (Fc)-Avi-tagged | +Inquiry |
RTKN-5192R | Recombinant Rat RTKN Protein | +Inquiry |
Rtkn-8058R | Recombinant Rat Rtkn protein, His & T7-tagged | +Inquiry |
RTKN-6216H | Recombinant Human RTKN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTKN-2124HCL | Recombinant Human RTKN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTKN Products
Required fields are marked with *
My Review for All RTKN Products
Required fields are marked with *
0
Inquiry Basket