Recombinant Human RTN4 protein, GST-tagged
Cat.No. : | RTN4-310H |
Product Overview : | Recombinant Human RTN4 protein(NP_008939)(1-199 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-199 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | RTN4 reticulon 4 [ Homo sapiens ] |
Official Symbol | RTN4 |
Synonyms | RTN4; reticulon 4; reticulon-4; ASY; KIAA0886; NOGO; NSP CL; foocen; Human NogoA; reticulon 5; My043 protein; neurite outgrowth inhibitor; neurite growth inhibitor 220; neuroendocrine-specific protein C homolog; NSP; NOGOC; RTN-X; NOGO-A; NSP-CL; Nogo-B; Nogo-C; RTN4-A; RTN4-C; RTN4-B1; RTN4-B2; NI220/250; Nbla00271; Nbla10545; |
Gene ID | 57142 |
mRNA Refseq | NM_007008 |
Protein Refseq | NP_008939 |
MIM | 604475 |
UniProt ID | Q9NQC3 |
◆ Recombinant Proteins | ||
RTN4-310H | Recombinant Human RTN4 protein, GST-tagged | +Inquiry |
RTN4-5195R | Recombinant Rat RTN4 Protein | +Inquiry |
RTN4-4051R | Recombinant Rhesus monkey RTN4 Protein, His-tagged | +Inquiry |
Rtn4-18R | Recombinant Rat Rtn4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTN4-3990H | Recombinant Human RTN4 protein(Met1-Val185), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTN4-2120HCL | Recombinant Human RTN4 293 Cell Lysate | +Inquiry |
RTN4-2121HCL | Recombinant Human RTN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTN4 Products
Required fields are marked with *
My Review for All RTN4 Products
Required fields are marked with *
0
Inquiry Basket