Recombinant Human RTN4 protein, GST-tagged

Cat.No. : RTN4-310H
Product Overview : Recombinant Human RTN4 protein(NP_008939)(1-199 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-199 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
Gene Name RTN4 reticulon 4 [ Homo sapiens ]
Official Symbol RTN4
Synonyms RTN4; reticulon 4; reticulon-4; ASY; KIAA0886; NOGO; NSP CL; foocen; Human NogoA; reticulon 5; My043 protein; neurite outgrowth inhibitor; neurite growth inhibitor 220; neuroendocrine-specific protein C homolog; NSP; NOGOC; RTN-X; NOGO-A; NSP-CL; Nogo-B; Nogo-C; RTN4-A; RTN4-C; RTN4-B1; RTN4-B2; NI220/250; Nbla00271; Nbla10545;
Gene ID 57142
mRNA Refseq NM_007008
Protein Refseq NP_008939
MIM 604475
UniProt ID Q9NQC3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTN4 Products

Required fields are marked with *

My Review for All RTN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon