Recombinant Human RUNX1T1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RUNX1T1-2942H | 
| Product Overview : | RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783554) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants. | 
| Molecular Mass : | 63.2 kDa | 
| AA Sequence : | MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | RUNX1T1 RUNX1 partner transcriptional co-repressor 1 [ Homo sapiens (human) ] | 
| Official Symbol | RUNX1T1 | 
| Synonyms | RUNX1T1; runt-related transcription factor 1; translocated to, 1 (cyclin D-related); AML1T1, CBFA2T1, core binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D related; protein CBFA2T1; CDR; ETO; MTG8; ZMYND2; eight twenty one protein; myeloid translocation gene on 8q22; zinc finger MYND domain-containing protein 2; acute myelogenous leukemia 1 translocation 1, cyclin-D related; core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D-related; AML1T1; CBFA2T1; MGC2796; FLJ33145; DKFZp564B213; | 
| Gene ID | 862 | 
| mRNA Refseq | NM_175636 | 
| Protein Refseq | NP_783554 | 
| MIM | 133435 | 
| UniProt ID | Q06455 | 
| ◆ Recombinant Proteins | ||
| Runx1t1-784M | Recombinant Mouse Runx1t1 Protein, MYC/DDK-tagged | +Inquiry | 
| RUNX1T1-4600Z | Recombinant Zebrafish RUNX1T1 | +Inquiry | 
| RUNX1T1-6309C | Recombinant Chicken RUNX1T1 | +Inquiry | 
| RUNX1T1-701H | Recombinant Human RUNX1T1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| RUNX1T1-1148H | Recombinant Human RUNX1T1 protein, His&Myc-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| RUNX1T1-2110HCL | Recombinant Human RUNX1T1 293 Cell Lysate | +Inquiry | 
| RUNX1T1-2109HCL | Recombinant Human RUNX1T1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All RUNX1T1 Products
Required fields are marked with *
My Review for All RUNX1T1 Products
Required fields are marked with *
  
        
    
      
            