Recombinant Human RYR3 Protein (3934-4181 aa), His-tagged
Cat.No. : | RYR3-790H |
Product Overview : | Recombinant Human RYR3 Protein (3934-4181 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3934-4181 aa |
Description : | Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis . Plays a role in cellular calcium signaling.1 Publication. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 32.5 kDa |
AA Sequence : | DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | RYR3 ryanodine receptor 3 [ Homo sapiens ] |
Official Symbol | RYR3 |
Synonyms | RYR3; ryanodine receptor 3; RYR-3; |
Gene ID | 6263 |
mRNA Refseq | NM_001036 |
Protein Refseq | NP_001027 |
MIM | 180903 |
UniProt ID | Q15413 |
◆ Recombinant Proteins | ||
RYR3-790H | Recombinant Human RYR3 Protein (3934-4181 aa), His-tagged | +Inquiry |
RYR3-7089C | Recombinant Chicken RYR3 | +Inquiry |
RYR3-4020H | Recombinant Human RYR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RYR3-359H | Recombinant Human RYR3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RYR3 Products
Required fields are marked with *
My Review for All RYR3 Products
Required fields are marked with *
0
Inquiry Basket