Recombinant Human RYR3 Protein, GST-tagged

• Cat.No.: RYR3-789H
• Product Overview: Recombinant Human RYR3 Protein(587-686 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 587-686 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MLLDKHGRNHKVLDILCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWAS
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: RYR3 ryanodine receptor 3 [ Homo sapiens ]
• Official Symbol: RYR3
• Synonyms: RYR3; ryanodine receptor 3; RYR-3; type 3 ryanodine receptor; brain-type ryanodine receptor; brain ryanodine receptor-calcium release channel
• Gene ID: 6263
• mRNA Refseq: NM_001036
• Protein Refseq: NP_001027
• MIM: 180903
• UniProt ID: Q15413