Recombinant Human S100A1 protein, His-SUMO-tagged

• Cat.No.: S100A1-3457H
• Product Overview: Recombinant Human S100A1 protein(P23297)(2-94aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-94aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.4 kDa
• AA Sequence: GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100A1 S100 calcium binding protein A1 [ Homo sapiens ]
• Official Symbol: S100A1
• Synonyms: S100A1; S100 calcium binding protein A1; S100 calcium binding protein A1 , S100A; protein S100-A1; S100 alpha; S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100; S100A; S100-alpha
• Gene ID: 6271
• mRNA Refseq: NM_006271
• Protein Refseq: NP_006262
• MIM: 176940
• UniProt ID: P23297