Recombinant Human S100A1 protein, His-SUMO-tagged
Cat.No. : | S100A1-3457H |
Product Overview : | Recombinant Human S100A1 protein(P23297)(2-94aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-94aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A1 S100 calcium binding protein A1 [ Homo sapiens ] |
Official Symbol | S100A1 |
Synonyms | S100A1; S100 calcium binding protein A1; S100 calcium binding protein A1 , S100A; protein S100-A1; S100 alpha; S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100; S100A; S100-alpha; |
Gene ID | 6271 |
mRNA Refseq | NM_006271 |
Protein Refseq | NP_006262 |
MIM | 176940 |
UniProt ID | P23297 |
◆ Recombinant Proteins | ||
S100A1-841H | Active Recombinant Human S100A1 protein(Gly2-Ser94), hFc-tagged | +Inquiry |
S100A1-554C | Recombinant Cattle S100A1 protein, His & GST-tagged | +Inquiry |
S100a1-556R | Recombinant Rat S100a1 protein, His-tagged | +Inquiry |
S100A1-31005TH | Recombinant Human S100A1 | +Inquiry |
S100A1-5645C | Recombinant Chicken S100A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A1-2861HCL | Recombinant Human S100A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A1 Products
Required fields are marked with *
My Review for All S100A1 Products
Required fields are marked with *