Recombinant Human S100A1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A1-1909H |
Product Overview : | S100A1 MS Standard C13 and N15-labeled recombinant protein (NP_006262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. |
Molecular Mass : | 10.5 kDa |
AA Sequence : | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A1 S100 calcium binding protein A1 [ Homo sapiens (human) ] |
Official Symbol | S100A1 |
Synonyms | S100A1; S100 calcium binding protein A1; S100 calcium binding protein A1, S100A; protein S100-A1; S100 alpha; S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100; S100A; S100-alpha; |
Gene ID | 6271 |
mRNA Refseq | NM_006271 |
Protein Refseq | NP_006262 |
MIM | 176940 |
UniProt ID | P23297 |
◆ Recombinant Proteins | ||
S100a1-7317M | Recombinant Mouse S100a1 Protein, His-tagged | +Inquiry |
S100A1-3718H | Recombinant Human S100A1, His-tagged | +Inquiry |
S100A1-554C | Recombinant Cattle S100A1 protein, His & GST-tagged | +Inquiry |
S100A1-4869R | Recombinant Rat S100A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A1-555H | Recombinant Human S100A1 protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A1-2861HCL | Recombinant Human S100A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A1 Products
Required fields are marked with *
My Review for All S100A1 Products
Required fields are marked with *