Recombinant Human S100A1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A1-1909H
• Product Overview: S100A1 MS Standard C13 and N15-labeled recombinant protein (NP_006262) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies.
• Molecular Mass: 10.5 kDa
• AA Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A1 S100 calcium binding protein A1 [ Homo sapiens (human) ]
• Official Symbol: S100A1
• Synonyms: S100A1; S100 calcium binding protein A1; S100 calcium binding protein A1, S100A; protein S100-A1; S100 alpha; S-100 protein alpha chain; S-100 protein subunit alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100; S100A; S100-alpha
• Gene ID: 6271
• mRNA Refseq: NM_006271
• Protein Refseq: NP_006262
• MIM: 176940
• UniProt ID: P23297