Recombinant Human S100A11 protein, His-SUMO-tagged
Cat.No. : | S100A11-3459H |
Product Overview : | Recombinant Human S100A11 protein(P31949)(2-105aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-105aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A11 S100 calcium binding protein A11 [ Homo sapiens ] |
Official Symbol | S100A11 |
Synonyms | S100A11; S100 calcium binding protein A11; S100 calcium binding protein A11 (calgizzarin) , S100 calcium binding protein A11 (calgizzarin); protein S100-A11; S100C; MLN 70; calgizzarin; protein S100-C; metastatic lymph node gene 70 protein; S100 calcium-binding protein A11 (calgizzarin); MLN70; |
Gene ID | 6282 |
mRNA Refseq | NM_005620 |
Protein Refseq | NP_005611 |
MIM | 603114 |
UniProt ID | P31949 |
◆ Recombinant Proteins | ||
S100A11-7865M | Recombinant Mouse S100A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A11-284H | Recombinant Human S100 calcium binding protein A11,His-tagged | +Inquiry |
S100A11-3102H | Recombinant Human S100A11, None tagged | +Inquiry |
S100A11-14612M | Recombinant Mouse S100A11 Protein | +Inquiry |
S100a11-5665M | Recombinant Mouse S100a11 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
S100A11-3111H | Native Human S100A11 protein(Met1-Thr105) | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A11-2095HCL | Recombinant Human S100A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A11 Products
Required fields are marked with *
My Review for All S100A11 Products
Required fields are marked with *
0
Inquiry Basket