Recombinant Human S100A11 protein, His-SUMO-tagged
Cat.No. : | S100A11-3459H |
Product Overview : | Recombinant Human S100A11 protein(P31949)(2-105aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
ProteinLength : | 2-105aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.6 kDa |
AA Sequence : | AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A11 S100 calcium binding protein A11 [ Homo sapiens ] |
Official Symbol | S100A11 |
Synonyms | S100A11; S100 calcium binding protein A11; S100 calcium binding protein A11 (calgizzarin) , S100 calcium binding protein A11 (calgizzarin); protein S100-A11; S100C; MLN 70; calgizzarin; protein S100-C; metastatic lymph node gene 70 protein; S100 calcium-binding protein A11 (calgizzarin); MLN70; |
Gene ID | 6282 |
mRNA Refseq | NM_005620 |
Protein Refseq | NP_005611 |
MIM | 603114 |
UniProt ID | P31949 |
◆ Recombinant Proteins | ||
SAP068A-051-1725S | Recombinant Staphylococcus aureus (strain: PM64, other: HA-MRSA) SAP068A_051 protein, His-tagged | +Inquiry |
RFL6718RF | Recombinant Full Length Rat Growth Hormone Secretagogue Receptor Type 1(Ghsr) Protein, His-Tagged | +Inquiry |
ZNF395-30781TH | Recombinant Human ZNF395 | +Inquiry |
CD47 -0245M | Recombinant Mouse CD47 protein | +Inquiry |
PYCARD-3535R | Recombinant Rhesus Macaque PYCARD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FTH1-1868H | Native Human Ferritin, Heavy Polypeptide 1 | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
b-Glucosidase-10S | Active Native Sweet Almonds b-Glucosidase | +Inquiry |
C3-194H | Native Human Complement C3c | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-442S | Sheep Skin Lysate, Total Protein | +Inquiry |
Eye-642B | Bovine Eye, Lens Lysate, Total Protein | +Inquiry |
C6orf106-8003HCL | Recombinant Human C6orf106 293 Cell Lysate | +Inquiry |
AASDHPPT-2HCL | Recombinant Human AASDHPPT cell lysate | +Inquiry |
RPS6KA3-2161HCL | Recombinant Human RPS6KA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A11 Products
Required fields are marked with *
My Review for All S100A11 Products
Required fields are marked with *
0
Inquiry Basket