Recombinant Human S100A3 protein, His-tagged
Cat.No. : | S100A3-3613H |
Product Overview : | Recombinant Human S100A3 protein(1-101 aa), fused to His tag, was expressed in E. coli. |
Availability | April 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-101 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | S100A3 S100 calcium binding protein A3 [ Homo sapiens ] |
Official Symbol | S100A3 |
Synonyms | S100A3; S100 calcium binding protein A3; S100 calcium binding protein A3 , S100E; protein S100-A3; S100 calcium-binding protein A3; S100E; |
Gene ID | 6274 |
mRNA Refseq | NM_002960 |
Protein Refseq | NP_002951 |
MIM | 176992 |
UniProt ID | P33764 |
◆ Recombinant Proteins | ||
S100a3-7321M | Recombinant Mouse S100a3 Protein, His-tagged | +Inquiry |
S100A3-3541H | Recombinant Human S100A3, His-tagged | +Inquiry |
S100A3-6214H | Recombinant Human S100A3 Protein (Met1-Gln101), N-His tagged | +Inquiry |
S100A3-2488H | Recombinant Human S100A3, GST-tagged | +Inquiry |
S100A3-4871R | Recombinant Rat S100A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A3 Products
Required fields are marked with *
My Review for All S100A3 Products
Required fields are marked with *
0
Inquiry Basket