Recombinant Human S100A3 protein, His-tagged
| Cat.No. : | S100A3-3613H |
| Product Overview : | Recombinant Human S100A3 protein(1-101 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | S100A3 S100 calcium binding protein A3 [ Homo sapiens ] |
| Official Symbol | S100A3 |
| Synonyms | S100A3; S100 calcium binding protein A3; S100 calcium binding protein A3 , S100E; protein S100-A3; S100 calcium-binding protein A3; S100E; |
| Gene ID | 6274 |
| mRNA Refseq | NM_002960 |
| Protein Refseq | NP_002951 |
| MIM | 176992 |
| UniProt ID | P33764 |
| ◆ Recombinant Proteins | ||
| S100a3-6962M | Recombinant Mouse S100 Calcium Binding Protein A3, His-tagged | +Inquiry |
| S100a3-531M | Recombinant Mouse S100a3 protein, His-tagged | +Inquiry |
| S100A3-14617M | Recombinant Mouse S100A3 Protein | +Inquiry |
| S100A3-4871R | Recombinant Rat S100A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| S100a3-7321M | Recombinant Mouse S100a3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A3 Products
Required fields are marked with *
My Review for All S100A3 Products
Required fields are marked with *
