Recombinant Human S100A3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | S100A3-3279H |
| Product Overview : | S100A3 MS Standard C13 and N15-labeled recombinant protein (NP_002951) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. |
| Molecular Mass : | 11.7 kDa |
| AA Sequence : | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | S100A3 S100 calcium binding protein A3 [ Homo sapiens (human) ] |
| Official Symbol | S100A3 |
| Synonyms | S100A3; S100 calcium binding protein A3; S100 calcium binding protein A3, S100E; protein S100-A3; S100 calcium-binding protein A3; S100E; |
| Gene ID | 6274 |
| mRNA Refseq | NM_002960 |
| Protein Refseq | NP_002951 |
| MIM | 176992 |
| UniProt ID | P33764 |
| ◆ Recombinant Proteins | ||
| S100A3-6214H | Recombinant Human S100A3 Protein (Met1-Gln101), N-His tagged | +Inquiry |
| S100a3-531M | Recombinant Mouse S100a3 protein, His-tagged | +Inquiry |
| S100a3-6962M | Recombinant Mouse S100 Calcium Binding Protein A3, His-tagged | +Inquiry |
| S100A3-3613H | Recombinant Human S100A3 protein, His-tagged | +Inquiry |
| S100A3-7866M | Recombinant Mouse S100A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A3 Products
Required fields are marked with *
My Review for All S100A3 Products
Required fields are marked with *
