Recombinant Human S100A3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A3-3279H
• Product Overview: S100A3 MS Standard C13 and N15-labeled recombinant protein (NP_002951) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.
• Molecular Mass: 11.7 kDa
• AA Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A3 S100 calcium binding protein A3 [ Homo sapiens (human) ]
• Official Symbol: S100A3
• Synonyms: S100A3; S100 calcium binding protein A3; S100 calcium binding protein A3, S100E; protein S100-A3; S100 calcium-binding protein A3; S100E
• Gene ID: 6274
• mRNA Refseq: NM_002960
• Protein Refseq: NP_002951
• MIM: 176992
• UniProt ID: P33764