Recombinant Human S100A6 protein, His-SUMO-tagged
Cat.No. : | S100A6-3462H |
Product Overview : | Recombinant Human S100A6 protein(P06703)(1-90aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-90aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | S100A6 S100 calcium binding protein A6 [ Homo sapiens ] |
Official Symbol | S100A6 |
Synonyms | S100A6; S100 calcium binding protein A6; CACY, S100 calcium binding protein A6 (calcyclin) , S100 calcium binding protein A6 (calcyclin); protein S100-A6; 2A9; CABP; PRA; MLN 4; calcyclin; growth factor-inducible protein 2A9; prolactin receptor-associated protein; S100 calcium-binding protein A6 (calcyclin); 5B10; CACY; |
Gene ID | 6277 |
mRNA Refseq | NM_014624 |
Protein Refseq | NP_055439 |
MIM | 114110 |
UniProt ID | P06703 |
◆ Recombinant Proteins | ||
S100A6-916H | Recombinant Human S100A6, His-tagged | +Inquiry |
S100A6-5724C | Recombinant Chicken S100A6 | +Inquiry |
S100a6-5106M | Recombinant Mouse S100 calcium Binding Protein A6 (calcyclin), His-tagged | +Inquiry |
S100A6-620H | Recombinant Human S100A6 Protein | +Inquiry |
S100A6-2544H | Recombinant Human S100A6 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100a6-43M | Native Mouse S100A6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A6-690HCL | Recombinant Human S100A6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A6 Products
Required fields are marked with *
My Review for All S100A6 Products
Required fields are marked with *
0
Inquiry Basket