Recombinant Human S100A6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A6-4913H |
Product Overview : | S100A6 MS Standard C13 and N15-labeled recombinant protein (NP_055439) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma. |
Molecular Mass : | 10.2 kDa |
AA Sequence : | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A6 S100 calcium binding protein A6 [ Homo sapiens (human) ] |
Official Symbol | S100A6 |
Synonyms | S100A6; S100 calcium binding protein A6; CACY, S100 calcium binding protein A6 (calcyclin), S100 calcium binding protein A6 (calcyclin); protein S100-A6; 2A9; CABP; PRA; MLN 4; calcyclin; growth factor-inducible protein 2A9; prolactin receptor-associated protein; S100 calcium-binding protein A6 (calcyclin); 5B10; CACY; |
Gene ID | 6277 |
mRNA Refseq | NM_014624 |
Protein Refseq | NP_055439 |
MIM | 114110 |
UniProt ID | P06703 |
◆ Recombinant Proteins | ||
S100A6-3100M | Recombinant Mouse S100A6 protein(Met1-Lys89) | +Inquiry |
S100A6-620H | Recombinant Human S100A6 Protein | +Inquiry |
S100A6-3880R | Recombinant Rhesus Macaque S100A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100A6-4063R | Recombinant Rhesus monkey S100A6 Protein, His-tagged | +Inquiry |
S100A6-4913H | Recombinant Human S100A6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
S100a6-43M | Native Mouse S100A6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A6-690HCL | Recombinant Human S100A6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A6 Products
Required fields are marked with *
My Review for All S100A6 Products
Required fields are marked with *