Recombinant human S100A8 Protein, Tag Free
Cat.No. : | S100A8-28639TH |
Product Overview : | Recombinant human S100A8 was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-93 aa |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Source : | E. coli |
Species : | Human |
Tag : | Non |
Form : | Liquid |
Molecular Mass : | 10.8 Da (93aa) confirmed by MALDI-TOF |
AA Sequence : | MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Gene Name | S100A8 S100 calcium binding protein A8 [ Homo sapiens (human) ] |
Official Symbol | S100A8 |
Synonyms | S100A8; S100 calcium binding protein A8; CAGA, CFAG, S100 calcium binding protein A8 (calgranulin A) , S100 calcium binding protein A8 (calgranulin A); protein S100-A8; 60B8AG; CGLA; MRP8; P8; MRP-8; calgranulin A; calgranulin-A; cystic fibrosis antigen; calprotectin L1L subunit; urinary stone protein band A; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; S100 calcium-binding protein A8 (calgranulin A); MIF; NIF; CAGA; CFAG; L1Ag; CP-10; MA387 |
Gene ID | 6279 |
mRNA Refseq | NM_002964 |
Protein Refseq | NP_002955 |
MIM | 123885 |
UniProt ID | P05109 |
◆ Recombinant Proteins | ||
S100A8-2710H | Recombinant Human S100A8 Protein, His-tagged | +Inquiry |
S100A8-3387M | Recombinant Mouse S100A8 protein, His-tagged | +Inquiry |
S100A8-0316D | Recombinant Dog S100A8 Protein, His-tagged | +Inquiry |
S100A8-432H | Recombinant Human S100A8 protein | +Inquiry |
S100A8-2709H | Recombinant Human S100A8 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A8-685HCL | Recombinant Human S100A8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A8 Products
Required fields are marked with *
My Review for All S100A8 Products
Required fields are marked with *