Recombinant human S100A8 Protein, Tag Free

Cat.No. : S100A8-28639TH
Product Overview : Recombinant human S100A8 was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-93 aa
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Source : E. coli
Species : Human
Tag : Non
Form : Liquid
Molecular Mass : 10.8 Da (93aa) confirmed by MALDI-TOF
AA Sequence : MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Gene Name S100A8 S100 calcium binding protein A8 [ Homo sapiens (human) ]
Official Symbol S100A8
Synonyms S100A8; S100 calcium binding protein A8; CAGA, CFAG, S100 calcium binding protein A8 (calgranulin A) , S100 calcium binding protein A8 (calgranulin A); protein S100-A8; 60B8AG; CGLA; MRP8; P8; MRP-8; calgranulin A; calgranulin-A; cystic fibrosis antigen; calprotectin L1L subunit; urinary stone protein band A; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; S100 calcium-binding protein A8 (calgranulin A); MIF; NIF; CAGA; CFAG; L1Ag; CP-10; MA387
Gene ID 6279
mRNA Refseq NM_002964
Protein Refseq NP_002955
MIM 123885
UniProt ID P05109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100A8 Products

Required fields are marked with *

My Review for All S100A8 Products

Required fields are marked with *

0
cart-icon
0
compare icon