Recombinant Human S100B Protein, His-tagged

Cat.No. : S100B-64H
Product Overview : Recombinant Human S100 Calcium Binding Protein B is produced by our E.coli expression system and the target gene encoding Met1-Glu92 is expressed with a 6His tag at the N-terminus.
Availability December 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Met1-Glu92
Description : S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B contains two EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B plays an important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotective effects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increases following brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into the blood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytes are the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominant S100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations in serum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before gross changes develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. In addition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancy both in bioptic tissue and in serum.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PBS,150mM NaCl, pH7.4.
AA Sequence : MNHKVHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVM ETLDNDGDGECDF QEFMAFVAMVTTACHEFFEHEC
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20centigrade for 3 months.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name S100B S100 calcium binding protein B [ Homo sapiens (human) ]
Official Symbol S100B
Synonyms Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100b; S100 beta; S100 calcium binding protein B; NEF; S100; S100-B; S100beta
Gene ID 6285
mRNA Refseq NM_006272.3
Protein Refseq NP_006263.1
MIM 176990
UniProt ID P04271

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100B Products

Required fields are marked with *

My Review for All S100B Products

Required fields are marked with *

0
cart-icon
0
compare icon