Recombinant Human S100B Protein, His-tagged
Cat.No. : | S100B-64H |
Product Overview : | Recombinant Human S100 Calcium Binding Protein B is produced by our E.coli expression system and the target gene encoding Met1-Glu92 is expressed with a 6His tag at the N-terminus. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Met1-Glu92 |
Description : | S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B contains two EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B plays an important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotective effects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increases following brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into the blood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytes are the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominant S100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations in serum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before gross changes develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. In addition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancy both in bioptic tissue and in serum. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PBS,150mM NaCl, pH7.4. |
AA Sequence : | MNHKVHHHHHHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVM ETLDNDGDGECDF QEFMAFVAMVTTACHEFFEHEC |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | S100B S100 calcium binding protein B [ Homo sapiens (human) ] |
Official Symbol | S100B |
Synonyms | Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100b; S100 beta; S100 calcium binding protein B; NEF; S100; S100-B; S100beta |
Gene ID | 6285 |
mRNA Refseq | NM_006272.3 |
Protein Refseq | NP_006263.1 |
MIM | 176990 |
UniProt ID | P04271 |
◆ Recombinant Proteins | ||
S100B-68H | Active Recombinant Human S100B protein(Ser2-Glu92), hFc-tagged | +Inquiry |
S100B-5217R | Recombinant Rat S100B Protein | +Inquiry |
S100B-2493H | Recombinant Full Length Human S100B, GST-tagged | +Inquiry |
S100B-3633H | Recombinant Human S100B protein, GST-tagged | +Inquiry |
S100b-2571M | Recombinant Mouse S100b, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100B Products
Required fields are marked with *
My Review for All S100B Products
Required fields are marked with *