Recombinant Human S100B Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100B-042H |
Product Overview : | S100B MS Standard C13 and N15-labeled recombinant protein (NP_006263) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. |
Molecular Mass : | 10.7 kDa |
AA Sequence : | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100B S100 calcium binding protein B [ Homo sapiens (human) ] |
Official Symbol | S100B |
Synonyms | S100B; S100 calcium binding protein B; NEF; S100; S100-B; S100beta; protein S100-B; S-100 calcium-binding protein, beta chain; S-100 protein subunit beta; S100 calcium-binding protein, beta (neural) |
Gene ID | 6285 |
mRNA Refseq | NM_006272 |
Protein Refseq | NP_006263 |
MIM | 176990 |
UniProt ID | P04271 |
◆ Recombinant Proteins | ||
S100B-34H | Recombinant Full Length Human S100B protein | +Inquiry |
S100B-31010TH | Active Recombinant Human S100B protein(Ser2-Glu92), His-tagged | +Inquiry |
S100b-2570M | Recombinant Mouse S100b protein, His-tagged | +Inquiry |
S100B-5623C | Recombinant Chicken S100B | +Inquiry |
S100B-3882R | Recombinant Rhesus Macaque S100B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-1116H | Native Human S100B Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100B Products
Required fields are marked with *
My Review for All S100B Products
Required fields are marked with *
0
Inquiry Basket