Recombinant Human S100B protein(11-80 aa), C-His-tagged
| Cat.No. : | S100B-2542H |
| Product Overview : | Recombinant Human S100B protein(P04271)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-80 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 10.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | LIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM |
| Gene Name | S100B S100 calcium binding protein B [ Homo sapiens ] |
| Official Symbol | S100B |
| Synonyms | S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B; |
| Gene ID | 6285 |
| mRNA Refseq | NM_006272 |
| Protein Refseq | NP_006263 |
| MIM | 176990 |
| UniProt ID | P04271 |
| ◆ Recombinant Proteins | ||
| S100B-673Z | Recombinant Zebrafish S100B | +Inquiry |
| S100B-544R | Recombinant Rhesus S100B protein | +Inquiry |
| S100B-042H | Recombinant Human S100B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| S100B-3543B | Recombinant Bovine S100B protein, His-Avi-tagged | +Inquiry |
| S100B-1703C | Recombinant Canine S100B protein, hFc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| S100B-257B | Native Bovine S-100b Protein | +Inquiry |
| S100B-1116H | Native Human S100B Protein | +Inquiry |
| S100B-256B | Native Bovine S-100 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
| S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100B Products
Required fields are marked with *
My Review for All S100B Products
Required fields are marked with *
