Recombinant Human S100B protein(11-80 aa), C-His-tagged
Cat.No. : | S100B-2542H |
Product Overview : | Recombinant Human S100B protein(P04271)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-80 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 10.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | LIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM |
Gene Name | S100B S100 calcium binding protein B [ Homo sapiens ] |
Official Symbol | S100B |
Synonyms | S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B; |
Gene ID | 6285 |
mRNA Refseq | NM_006272 |
Protein Refseq | NP_006263 |
MIM | 176990 |
UniProt ID | P04271 |
◆ Recombinant Proteins | ||
S100B-2542H | Recombinant Human S100B protein(11-80 aa), C-His-tagged | +Inquiry |
S100B-3633H | Recombinant Human S100B protein, GST-tagged | +Inquiry |
S100B-5482R | Recombinant Rhesus Macaque S100 Calcium Binding Protein B | +Inquiry |
S100B-2724H | Recombinant Full Length Human S100B Protein, His-tagged | +Inquiry |
S100B-2579R | Recombinant Rabbit S100B protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-1116H | Native Human S100B Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
S100B-1418MCL | Recombinant Mouse S100B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100B Products
Required fields are marked with *
My Review for All S100B Products
Required fields are marked with *