Recombinant Human S100B protein(11-80 aa), C-His-tagged

• Cat.No.: S100B-2542H
• Product Overview: Recombinant Human S100B protein(P04271)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-80 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 10.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM

Gene Information

• Gene Name: S100B S100 calcium binding protein B [ Homo sapiens ]
• Official Symbol: S100B
• Synonyms: S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B
• Gene ID: 6285
• mRNA Refseq: NM_006272
• Protein Refseq: NP_006263
• MIM: 176990
• UniProt ID: P04271