Recombinant Human S100B protein(11-80 aa), C-His-tagged

Cat.No. : S100B-2542H
Product Overview : Recombinant Human S100B protein(P04271)(11-80 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 11-80 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 10.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
Gene Name S100B S100 calcium binding protein B [ Homo sapiens ]
Official Symbol S100B
Synonyms S100B; S100 calcium binding protein B; S100 calcium binding protein, beta (neural); protein S100-B; S100beta; S-100 protein subunit beta; S-100 calcium-binding protein, beta chain; S100 calcium-binding protein, beta (neural); NEF; S100; S100-B;
Gene ID 6285
mRNA Refseq NM_006272
Protein Refseq NP_006263
MIM 176990
UniProt ID P04271

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100B Products

Required fields are marked with *

My Review for All S100B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon