Recombinant Human S1PR3

Cat.No. : S1PR3-28463TH
Product Overview : Recombinant fragment of Human EDG3 with a N terminal proprietary tag: predicted molecular weight 34.10 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 77 amino acids
Description : This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function.
Molecular Weight : 34.100kDa inclusive of tags
Tissue specificity : Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name S1PR3 sphingosine-1-phosphate receptor 3 [ Homo sapiens ]
Official Symbol S1PR3
Synonyms S1PR3; sphingosine-1-phosphate receptor 3; EDG3, endothelial differentiation, sphingolipid G protein coupled receptor, 3; sphingosine 1-phosphate receptor 3; EDG 3; sphingosine 1 phosphate receptor 3;
Gene ID 1903
mRNA Refseq NM_005226
Protein Refseq NP_005217
MIM 601965
Uniprot ID Q99500
Chromosome Location 9q22.1-q22.2
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Lysosphingolipid and LPA receptors, organism-specific biosystem;
Function G-protein coupled receptor activity; lipid binding; lysosphingolipid and lysophosphatidic acid receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S1PR3 Products

Required fields are marked with *

My Review for All S1PR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon