Recombinant Human S1PR3
Cat.No. : | S1PR3-28463TH |
Product Overview : | Recombinant fragment of Human EDG3 with a N terminal proprietary tag: predicted molecular weight 34.10 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 77 amino acids |
Description : | This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. |
Molecular Weight : | 34.100kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | S1PR3 sphingosine-1-phosphate receptor 3 [ Homo sapiens ] |
Official Symbol | S1PR3 |
Synonyms | S1PR3; sphingosine-1-phosphate receptor 3; EDG3, endothelial differentiation, sphingolipid G protein coupled receptor, 3; sphingosine 1-phosphate receptor 3; EDG 3; sphingosine 1 phosphate receptor 3; |
Gene ID | 1903 |
mRNA Refseq | NM_005226 |
Protein Refseq | NP_005217 |
MIM | 601965 |
Uniprot ID | Q99500 |
Chromosome Location | 9q22.1-q22.2 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Lysosphingolipid and LPA receptors, organism-specific biosystem; |
Function | G-protein coupled receptor activity; lipid binding; lysosphingolipid and lysophosphatidic acid receptor activity; receptor activity; signal transducer activity; |
◆ Cell & Tissue Lysates | ||
S1PR3-2084HCL | Recombinant Human S1PR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S1PR3 Products
Required fields are marked with *
My Review for All S1PR3 Products
Required fields are marked with *