Recombinant Human SAE1, His-tagged
Cat.No. : | SAE1-29262TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 18-346 of Human SAE1 with N terminal His tag; 329 amino acids, Predicted Mwt 37kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 18-346 a.a. |
Description : | Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al. |
Conjugation : | HIS |
Tissue specificity : | Expression level increases during S phase and drops in G2 phase (at protein level). |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLIL AGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEAS LERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCS RDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHE FVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKV VFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRT DKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPE DFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK |
Sequence Similarities : | Belongs to the ubiquitin-activating E1 family. |
Gene Name | SAE1 SUMO1 activating enzyme subunit 1 [ Homo sapiens ] |
Official Symbol | SAE1 |
Synonyms | SAE1; SUMO1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; activator Of sumo 1; AOS1; FLJ3091; Sua1; |
Gene ID | 10055 |
mRNA Refseq | NM_001145713 |
Protein Refseq | NP_001139185 |
MIM | 613294 |
Uniprot ID | Q9UBE0 |
Chromosome Location | 19q13.32 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | ATP-dependent protein binding; contributes_to SUMO activating enzyme activity; enzyme activator activity; ligase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
SAE1-1072H | Recombinant Human SAE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SAE1-222H | Recombinant Human SAE1 Protein, MYC/DDK-tagged | +Inquiry |
SAE1-4882R | Recombinant Rat SAE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAE1-4889H | Recombinant Human SAE1 protein, GST-tagged | +Inquiry |
SAE1-61H | Recombinant Human SUMO1 Activating Enzyme Subunit 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAE1-001HCL | Recombinant Human SAE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAE1 Products
Required fields are marked with *
My Review for All SAE1 Products
Required fields are marked with *