Recombinant Human SAG protein, His-tagged
| Cat.No. : | SAG-3766H |
| Product Overview : | Recombinant Human SAG protein(332-405 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 332-405 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SAG S-antigen; retina and pineal gland (arrestin) [ Homo sapiens ] |
| Official Symbol | SAG |
| Synonyms | SAG; S-antigen; retina and pineal gland (arrestin); S-arrestin; ARRESTIN; arrestin 1; 48 kDa protein; rod photoreceptor arrestin; retinal S-antigen (48 KDa protein); RP47; S-AG; DKFZp686D1084; DKFZp686I1383; |
| Gene ID | 6295 |
| mRNA Refseq | NM_000541 |
| Protein Refseq | NP_000532 |
| MIM | 181031 |
| UniProt ID | P10523 |
| ◆ Recombinant Proteins | ||
| Sag-3469M | Recombinant Mouse Sag protein, His-tagged | +Inquiry |
| SAG-283H | Recombinant Human SAG Protein, MYC/DDK-tagged | +Inquiry |
| SAG-4884R | Recombinant Rat SAG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SAG-1950H | Recombinant Human SAG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SAG-2501H | Recombinant Human SAG protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SAG Products
Required fields are marked with *
My Review for All SAG Products
Required fields are marked with *
