Recombinant Human SAP18 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SAP18-4660H
Product Overview : SAP18 MS Standard C13 and N15-labeled recombinant protein (NP_005861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2.
Molecular Mass : 17.6 kDa
AA Sequence : MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SAP18 Sin3A associated protein 18 [ Homo sapiens (human) ]
Official Symbol SAP18
Synonyms SAP18; Sin3A-associated protein, 18kDa; sin3A associated protein, 18kDa; histone deacetylase complex subunit SAP18; 2HOR0202; MGC27131; SAP18p; sin3-associated polypeptide p18; sin3-associated polypeptide, p18; cell growth inhibiting protein 38; cell growth-inhibiting protein 38; 18 kDa Sin3-associated polypeptide; sin3-associated polypeptide, 18 kDa; cell growth-inhibiting gene 38 protein; histone deacetlyase complex subunit SAP18; SAP18P;
Gene ID 10284
mRNA Refseq NM_005870
Protein Refseq NP_005861
MIM 602949
UniProt ID O00422

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SAP18 Products

Required fields are marked with *

My Review for All SAP18 Products

Required fields are marked with *

0
cart-icon