Recombinant Human SAP30 protein, His-tagged
Cat.No. : | SAP30-3031H |
Product Overview : | Recombinant Human SAP30 protein(68 - 197 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 68 - 197 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SAP30 Sin3A-associated protein, 30kDa [ Homo sapiens ] |
Official Symbol | SAP30 |
Synonyms | SAP30; Sin3A-associated protein, 30kDa; sin3A associated protein, 30kDa; histone deacetylase complex subunit SAP30; sin3-associated polypeptide p30; 30 kDa Sin3-associated polypeptide; Sin3-associated polypeptide, 30kDa; sin3-associated polypeptide, 30 kDa; Sin3 corepressor complex subunit SAP30; |
Gene ID | 8819 |
mRNA Refseq | NM_003864 |
Protein Refseq | NP_003855 |
MIM | 603378 |
UniProt ID | O75446 |
◆ Recombinant Proteins | ||
SAP30-14669M | Recombinant Mouse SAP30 Protein | +Inquiry |
SAP30-3031H | Recombinant Human SAP30 protein, His-tagged | +Inquiry |
SAP30-3889R | Recombinant Rhesus Macaque SAP30 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP30-4072R | Recombinant Rhesus monkey SAP30 Protein, His-tagged | +Inquiry |
SAP30-7899M | Recombinant Mouse SAP30 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAP30-1559HCL | Recombinant Human SAP30 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAP30 Products
Required fields are marked with *
My Review for All SAP30 Products
Required fields are marked with *
0
Inquiry Basket