Recombinant Human SCN8A protein, His-tagged

Cat.No. : SCN8A-2751H
Product Overview : Recombinant Human SCN8A protein(1767-1907 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability January 15, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1767-1907 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name SCN8A sodium channel, voltage gated, type VIII, alpha subunit [ Homo sapiens ]
Official Symbol SCN8A
Synonyms SCN8A; sodium channel, voltage gated, type VIII, alpha subunit; MED, sodium channel, voltage gated, type VIII, alpha polypeptide; sodium channel protein type 8 subunit alpha; CerIII; NaCh6; Nav1.6; PN4; hNa6/Scn8a voltage-gated sodium channel; voltage-gated sodium channel subunit alpha Nav1.6; MED; CIAT; CERIII; EIEE13; FLJ33996;
Gene ID 6334
mRNA Refseq NM_001177984
Protein Refseq NP_001171455
MIM 600702
UniProt ID Q9UQD0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCN8A Products

Required fields are marked with *

My Review for All SCN8A Products

Required fields are marked with *

0
cart-icon
0
compare icon