Recombinant Human SCN8A protein, His-tagged

• Cat.No.: SCN8A-2751H
• Product Overview: Recombinant Human SCN8A protein(1767-1907 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1767-1907 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SCN8A sodium channel, voltage gated, type VIII, alpha subunit [ Homo sapiens ]
• Official Symbol: SCN8A
• Synonyms: SCN8A; sodium channel, voltage gated, type VIII, alpha subunit; MED, sodium channel, voltage gated, type VIII, alpha polypeptide; sodium channel protein type 8 subunit alpha; CerIII; NaCh6; Nav1.6; PN4; hNa6/Scn8a voltage-gated sodium channel; voltage-gated sodium channel subunit alpha Nav1.6; MED; CIAT; CERIII; EIEE13; FLJ33996
• Gene ID: 6334
• mRNA Refseq: NM_001177984
• Protein Refseq: NP_001171455
• MIM: 600702
• UniProt ID: Q9UQD0