Recombinant Human SCN8A protein, GST-tagged

Cat.No. : SCN8A-301483H
Product Overview : Recombinant Human SCN8A (1767-1907 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1767-Glu1907
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SCN8A sodium channel, voltage gated, type VIII, alpha subunit [ Homo sapiens ]
Official Symbol SCN8A
Synonyms SCN8A; sodium channel, voltage gated, type VIII, alpha subunit; MED, sodium channel, voltage gated, type VIII, alpha polypeptide; sodium channel protein type 8 subunit alpha; CerIII; NaCh6; Nav1.6; PN4; hNa6/Scn8a voltage-gated sodium channel; voltage-gated sodium channel subunit alpha Nav1.6; MED; CIAT; CERIII; EIEE13; FLJ33996;
Gene ID 6334
mRNA Refseq NM_001177984
Protein Refseq NP_001171455
MIM 600702
UniProt ID Q9UQD0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCN8A Products

Required fields are marked with *

My Review for All SCN8A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon