Recombinant Human SCN8A protein, GST-tagged
Cat.No. : | SCN8A-301483H |
Product Overview : | Recombinant Human SCN8A (1767-1907 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1767-Glu1907 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SCN8A sodium channel, voltage gated, type VIII, alpha subunit [ Homo sapiens ] |
Official Symbol | SCN8A |
Synonyms | SCN8A; sodium channel, voltage gated, type VIII, alpha subunit; MED, sodium channel, voltage gated, type VIII, alpha polypeptide; sodium channel protein type 8 subunit alpha; CerIII; NaCh6; Nav1.6; PN4; hNa6/Scn8a voltage-gated sodium channel; voltage-gated sodium channel subunit alpha Nav1.6; MED; CIAT; CERIII; EIEE13; FLJ33996; |
Gene ID | 6334 |
mRNA Refseq | NM_001177984 |
Protein Refseq | NP_001171455 |
MIM | 600702 |
UniProt ID | Q9UQD0 |
◆ Recombinant Proteins | ||
SCN8A-4928R | Recombinant Rat SCN8A Protein, His (Fc)-Avi-tagged | +Inquiry |
SCN8A-2751H | Recombinant Human SCN8A protein, His-tagged | +Inquiry |
SCN8A-301483H | Recombinant Human SCN8A protein, GST-tagged | +Inquiry |
SCN8A-5269R | Recombinant Rat SCN8A Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN8A Products
Required fields are marked with *
My Review for All SCN8A Products
Required fields are marked with *
0
Inquiry Basket