Recombinant Human SCN8A protein, GST-tagged
| Cat.No. : | SCN8A-301483H |
| Product Overview : | Recombinant Human SCN8A protein(1767-1907 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1767-1907 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SCN8A sodium channel, voltage gated, type VIII, alpha subunit [ Homo sapiens ] |
| Official Symbol | SCN8A |
| Synonyms | SCN8A; sodium channel, voltage gated, type VIII, alpha subunit; MED, sodium channel, voltage gated, type VIII, alpha polypeptide; sodium channel protein type 8 subunit alpha; CerIII; NaCh6; Nav1.6; PN4; hNa6/Scn8a voltage-gated sodium channel; voltage-gated sodium channel subunit alpha Nav1.6; MED; CIAT; CERIII; EIEE13; FLJ33996; |
| Gene ID | 6334 |
| mRNA Refseq | NM_001177984 |
| Protein Refseq | NP_001171455 |
| MIM | 600702 |
| UniProt ID | Q9UQD0 |
| ◆ Recombinant Proteins | ||
| SCN8A-2751H | Recombinant Human SCN8A protein, His-tagged | +Inquiry |
| SCN8A-5269R | Recombinant Rat SCN8A Protein | +Inquiry |
| SCN8A-301483H | Recombinant Human SCN8A protein, GST-tagged | +Inquiry |
| SCN8A-4928R | Recombinant Rat SCN8A Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCN8A Products
Required fields are marked with *
My Review for All SCN8A Products
Required fields are marked with *
