Recombinant Human SCOC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SCOC-4249H
Product Overview : SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants.
Molecular Mass : 13.9 kDa
AA Sequence : MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SCOC short coiled-coil protein [ Homo sapiens (human) ]
Official Symbol SCOC
Synonyms SCOC; short coiled-coil protein; SCOCO; UNC-69; HRIHFB2072; short coiled-coil protein
Gene ID 60592
mRNA Refseq NM_032547
Protein Refseq NP_115936
UniProt ID Q9UIL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SCOC Products

Required fields are marked with *

My Review for All SCOC Products

Required fields are marked with *

0
cart-icon