Recombinant Human SCOC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCOC-4249H
• Product Overview: SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 13.9 kDa
• AA Sequence: MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCOC short coiled-coil protein [ Homo sapiens (human) ]
• Official Symbol: SCOC
• Synonyms: SCOC; short coiled-coil protein; SCOCO; UNC-69; HRIHFB2072; short coiled-coil protein
• Gene ID: 60592
• mRNA Refseq: NM_032547
• Protein Refseq: NP_115936
• UniProt ID: Q9UIL1