Recombinant Human SCOC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SCOC-4249H |
Product Overview : | SCOC MS Standard C13 and N15-labeled recombinant protein (NP_115936) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SCOC short coiled-coil protein [ Homo sapiens (human) ] |
Official Symbol | SCOC |
Synonyms | SCOC; short coiled-coil protein; SCOCO; UNC-69; HRIHFB2072; short coiled-coil protein |
Gene ID | 60592 |
mRNA Refseq | NM_032547 |
Protein Refseq | NP_115936 |
UniProt ID | Q9UIL1 |
◆ Recombinant Proteins | ||
SCOC-4249H | Recombinant Human SCOC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCOC-4933R | Recombinant Rat SCOC Protein, His (Fc)-Avi-tagged | +Inquiry |
SCOC-7943M | Recombinant Mouse SCOC Protein, His (Fc)-Avi-tagged | +Inquiry |
SCOC-5274R | Recombinant Rat SCOC Protein | +Inquiry |
SCOC-301258H | Recombinant Human SCOC protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCOC-2024HCL | Recombinant Human SCOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCOC Products
Required fields are marked with *
My Review for All SCOC Products
Required fields are marked with *