Recombinant Human SCRG1 Protein (21-98 aa), His-SUMO-tagged
| Cat.No. : | SCRG1-996H |
| Product Overview : | Recombinant Human SCRG1 Protein (21-98 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-98 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 24.9 kDa |
| AA Sequence : | MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | SCRG1 stimulator of chondrogenesis 1 [ Homo sapiens ] |
| Official Symbol | SCRG1 |
| Synonyms | SCRG-1; |
| Gene ID | 11341 |
| mRNA Refseq | NM_007281.2 |
| Protein Refseq | NP_009212.1 |
| MIM | 603163 |
| UniProt ID | O75711 |
| ◆ Recombinant Proteins | ||
| SCRG1-14774M | Recombinant Mouse SCRG1 Protein | +Inquiry |
| SCRG1-1644M | Recombinant Mouse SCRG1 Protein (21-98 aa), His-tagged | +Inquiry |
| SCRG1-4353H | Recombinant Human SCRG1 protein, His-tagged | +Inquiry |
| SCRG1-991M | Recombinant Mouse SCRG1 Protein (21-98 aa), His-SUMO-tagged | +Inquiry |
| SCRG1-1647H | Recombinant Human SCRG1 Protein (21-98 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCRG1 Products
Required fields are marked with *
My Review for All SCRG1 Products
Required fields are marked with *
