Recombinant Human SDCBP Protein, His-tagged
| Cat.No. : | SDCBP-698H | 
| Product Overview : | Recombinant Human SDCBP, transcript variant 5, fused with His tag at C-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Description : | The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. | 
| Form : | Supplied as a 0.2 µm filtered solution of PBS, pH 7.4 | 
| Molecular Mass : | 33kD | 
| AA Sequence : | SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIAD | 
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). | 
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining | 
| Gene Name | SDCBP syndecan binding protein (syntenin) [ Homo sapiens ] | 
| Official Symbol | SDCBP | 
| Synonyms | SDCBP; syndecan binding protein (syntenin); syntenin-1; SYCL; scaffold protein Pbp1; syndecan-binding protein 1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; ST1; MDA-9; TACIP18; | 
| Gene ID | 6386 | 
| mRNA Refseq | NM_001007067 | 
| Protein Refseq | NP_001007068 | 
| MIM | 602217 | 
| UniProt ID | O00560 | 
| ◆ Recombinant Proteins | ||
| Sdcbp-5728M | Recombinant Mouse Sdcbp Protein, Myc/DDK-tagged | +Inquiry | 
| SDCBP-11967Z | Recombinant Zebrafish SDCBP | +Inquiry | 
| SDCBP-1038H | Recombinant Human SDCBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| SDCBP-6253H | Recombinant Human SDCBP Protein (Ser2-Val298), C-His tagged | +Inquiry | 
| SDCBP-14793M | Recombinant Mouse SDCBP Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SDCBP-2015HCL | Recombinant Human SDCBP 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDCBP Products
Required fields are marked with *
My Review for All SDCBP Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            