Recombinant Human SDCBP protein(2-298aa), His-GST-tagged
Cat.No. : | SDCBP-3767H |
Product Overview : | Recombinant Human SDCBP protein(O00560)(2-298aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 2-298aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 63.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV |
Gene Name | SDCBP syndecan binding protein (syntenin) [ Homo sapiens ] |
Official Symbol | SDCBP |
Synonyms | SDCBP; syndecan binding protein (syntenin); syntenin-1; SYCL; scaffold protein Pbp1; syndecan-binding protein 1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; ST1; MDA-9; TACIP18; |
Gene ID | 6386 |
mRNA Refseq | NM_001007067 |
Protein Refseq | NP_001007068 |
MIM | 602217 |
UniProt ID | O00560 |
◆ Recombinant Proteins | ||
SDCBP-11967Z | Recombinant Zebrafish SDCBP | +Inquiry |
SDCBP-4946R | Recombinant Rat SDCBP Protein, His (Fc)-Avi-tagged | +Inquiry |
SDCBP-3367H | Recombinant Human Syndecan Binding Protein (Syntenin), His-tagged | +Inquiry |
SDCBP-5287R | Recombinant Rat SDCBP Protein | +Inquiry |
SDCBP-3925R | Recombinant Rhesus Macaque SDCBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDCBP-2015HCL | Recombinant Human SDCBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDCBP Products
Required fields are marked with *
My Review for All SDCBP Products
Required fields are marked with *