Recombinant Human SDHAF3 Protein, GST-Tagged

Cat.No. : SDHAF3-162H
Product Overview : Human ACN9 full-length ORF (AAH20621.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SDHAF3 (Succinate Dehydrogenase Complex Assembly Factor 3) is a Protein Coding gene.
Molecular Mass : 40.15 kDa
AA Sequence : MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SDHAF3 succinate dehydrogenase complex assembly factor 3 [ Homo sapiens (human) ]
Official Symbol SDHAF3
Synonyms SDHAF3; succinate dehydrogenase complex assembly factor 3; Succinate Dehydrogenase Complex Assembly Factor 3; SDH Assembly Factor 3; ACN9; Succinate Dehydrogenase Assembly Factor 3, Mitochondrial; Protein ACN9 Homolog, Mitochondrial; ACN9 Homolog (S. Cerevisiae); ACN9 Homolog; LYRM10; DC11; Sdh7; succinate dehydrogenase assembly factor 3, mitochondrial; SDH assembly factor 3; protein ACN9 homolog, mitochondrial
Gene ID 57001
mRNA Refseq NM_020186
Protein Refseq NP_064571
MIM 615773
UniProt ID Q9NRP4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDHAF3 Products

Required fields are marked with *

My Review for All SDHAF3 Products

Required fields are marked with *

0
cart-icon