Recombinant Human SDHAF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SDHAF3-4471H
Product Overview : ACN9 MS Standard C13 and N15-labeled recombinant protein (NP_064571) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SDHAF3 (Succinate Dehydrogenase Complex Assembly Factor 3) is a Protein Coding gene. Diseases associated with SDHAF3 include Mitochondrial Complex Ii Deficiency and Alcohol Dependence.
Molecular Mass : 14.7 kDa
AA Sequence : MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SDHAF3 succinate dehydrogenase complex assembly factor 3 [ Homo sapiens (human) ]
Official Symbol SDHAF3
Synonyms SDHAF3; succinate dehydrogenase complex assembly factor 3; ACN9; DC11; Sdh7; LYRM10; succinate dehydrogenase assembly factor 3, mitochondrial; ACN9 homolog; SDH assembly factor 3; protein ACN9 homolog, mitochondrial
Gene ID 57001
mRNA Refseq NM_020186
Protein Refseq NP_064571
MIM 615773
UniProt ID Q9NRP4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDHAF3 Products

Required fields are marked with *

My Review for All SDHAF3 Products

Required fields are marked with *

0
cart-icon