Recombinant Human SDR42E1 Protein, GST-tagged
| Cat.No. : | SDR42E1-5128H |
| Product Overview : | Human HSPC105 full-length ORF ( NP_660151.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | SDR42E1 (Short Chain Dehydrogenase/Reductase Family 42E, Member 1) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and 3-beta-hydroxy-delta5-steroid dehydrogenase activity. An important paralog of this gene is SDR42E2. |
| Molecular Mass : | 69.6 kDa |
| AA Sequence : | MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SDR42E1 short chain dehydrogenase/reductase family 42E, member 1 [ Homo sapiens ] |
| Official Symbol | SDR42E1 |
| Synonyms | HSPC105 |
| Gene ID | 93517 |
| mRNA Refseq | NM_145168 |
| Protein Refseq | NP_660151 |
| UniProt ID | Q8WUS8 |
| ◆ Recombinant Proteins | ||
| SDR42E1-3584Z | Recombinant Zebrafish SDR42E1 | +Inquiry |
| SDR42E1-14813M | Recombinant Mouse SDR42E1 Protein | +Inquiry |
| SDR42E1-647C | Recombinant Cynomolgus Monkey SDR42E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL1125BF | Recombinant Full Length Bovine Short-Chain Dehydrogenase/Reductase Family 42E Member 1(Sdr42E1) Protein, His-Tagged | +Inquiry |
| SDR42E1-3934R | Recombinant Rhesus Macaque SDR42E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDR42E1 Products
Required fields are marked with *
My Review for All SDR42E1 Products
Required fields are marked with *
