Recombinant Human SEC13 protein, His-tagged
Cat.No. : | SEC13-5632H |
Product Overview : | Recombinant Human SEC13 protein(1-325 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-325 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | SEC13 |
Synonyms | SEC13; SEC13 homolog (S. cerevisiae); D3S1231E, SEC13 (S. cerevisiae) like 1 , SEC13 like 1 (S. cerevisiae) , SEC13L1; protein SEC13 homolog; npp 20; SEC13R; SEC13-like 1 isoform; SEC13-like protein 1; SEC13-related protein; npp-20; SEC13L1; D3S1231E; |
Gene ID | 6396 |
mRNA Refseq | NM_001136232 |
Protein Refseq | NP_001129704 |
MIM | 600152 |
UniProt ID | P55735 |
◆ Recombinant Proteins | ||
SEC13-7982M | Recombinant Mouse SEC13 Protein, His (Fc)-Avi-tagged | +Inquiry |
SEC13-4120R | Recombinant Rhesus monkey SEC13 Protein, His-tagged | +Inquiry |
SEC13-5193C | Recombinant Chicken SEC13 | +Inquiry |
SEC13-5298R | Recombinant Rat SEC13 Protein | +Inquiry |
SEC13-12520Z | Recombinant Zebrafish SEC13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC13-2000HCL | Recombinant Human SEC13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC13 Products
Required fields are marked with *
My Review for All SEC13 Products
Required fields are marked with *