Recombinant Human SEC22A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SEC22A-2354H |
Product Overview : | SEC22A MS Standard C13 and N15-labeled recombinant protein (NP_036562) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the member of the SEC22 family of vesicle trafficking proteins. This protein has similarity to rat SEC22 and may act in the early stages of the secretory pathway. |
Molecular Mass : | 34.9 kDa |
AA Sequence : | MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SEC22A SEC22 homolog A, vesicle trafficking protein [ Homo sapiens (human) ] |
Official Symbol | SEC22A |
Synonyms | SEC22A; SEC22 vesicle trafficking protein homolog A (S. cerevisiae); SEC22 vesicle trafficking protein like 2 (S. cerevisiae), SEC22L2; vesicle-trafficking protein SEC22a; sec22 homolog; SEC22 vesicle trafficking protein-like 2; SEC22 vesicle-trafficking protein-like 2; SEC22 vesicle-trafficking protein homolog A; SEC22L2; |
Gene ID | 26984 |
mRNA Refseq | NM_012430 |
Protein Refseq | NP_036562 |
MIM | 612442 |
UniProt ID | Q96IW7 |
◆ Recombinant Proteins | ||
SEC22A-1664C | Recombinant Chicken SEC22A | +Inquiry |
Sec22a-5743M | Recombinant Mouse Sec22a Protein, Myc/DDK-tagged | +Inquiry |
RFL6367RF | Recombinant Full Length Rat Vesicle-Trafficking Protein Sec22A(Sec22A) Protein, His-Tagged | +Inquiry |
RFL4695MF | Recombinant Full Length Mouse Vesicle-Trafficking Protein Sec22A(Sec22A) Protein, His-Tagged | +Inquiry |
SEC22A-3939R | Recombinant Rhesus Macaque SEC22A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC22A-1996HCL | Recombinant Human SEC22A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC22A Products
Required fields are marked with *
My Review for All SEC22A Products
Required fields are marked with *