Recombinant Human SEC22A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SEC22A-2354H
Product Overview : SEC22A MS Standard C13 and N15-labeled recombinant protein (NP_036562) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the member of the SEC22 family of vesicle trafficking proteins. This protein has similarity to rat SEC22 and may act in the early stages of the secretory pathway.
Molecular Mass : 34.9 kDa
AA Sequence : MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SEC22A SEC22 homolog A, vesicle trafficking protein [ Homo sapiens (human) ]
Official Symbol SEC22A
Synonyms SEC22A; SEC22 vesicle trafficking protein homolog A (S. cerevisiae); SEC22 vesicle trafficking protein like 2 (S. cerevisiae), SEC22L2; vesicle-trafficking protein SEC22a; sec22 homolog; SEC22 vesicle trafficking protein-like 2; SEC22 vesicle-trafficking protein-like 2; SEC22 vesicle-trafficking protein homolog A; SEC22L2;
Gene ID 26984
mRNA Refseq NM_012430
Protein Refseq NP_036562
MIM 612442
UniProt ID Q96IW7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEC22A Products

Required fields are marked with *

My Review for All SEC22A Products

Required fields are marked with *

0
cart-icon