Recombinant Human SELPLG protein, T7/His-tagged

Cat.No. : SELPLG-93H
Product Overview : Recombinant human CD162 cDNA (18 – 320 aa, Isoform-II, derived from BC029782), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 18-320 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGTRLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEML RNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVP TEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQT TPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSV SSVTHKGIPMAASNLSVNYPVGAPDHISVKQC
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro non-glycosylated CD162 protein mediated P-selectin related tumor metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CD162 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name SELPLG selectin P ligand [ Homo sapiens ]
Official Symbol SELPLG
Synonyms SELPLG; selectin P ligand; P-selectin glycoprotein ligand 1; CD162; PSGL 1; cutaneous lymphocyte-associated associated antigen; CLA; PSGL1; PSGL-1;
Gene ID 6404
mRNA Refseq NM_001206609
Protein Refseq NP_001193538
MIM 600738
UniProt ID Q14242
Chromosome Location 12q24
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Staphylococcus aureus infection, organism-specific biosystem
Function bacterial cell surface binding; protein binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SELPLG Products

Required fields are marked with *

My Review for All SELPLG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon