Recombinant Human SELPLG protein, T7/His-tagged
Cat.No. : | SELPLG-93H |
Product Overview : | Recombinant human CD162 cDNA (18 – 320 aa, Isoform-II, derived from BC029782), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 18-320 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGTRLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEML RNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAMEIQTTQPAATEAQTTQPVP TEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEAQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQT TPPAAMEAQTTQTTAMEAQTTAPEATEAQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSV SSVTHKGIPMAASNLSVNYPVGAPDHISVKQC |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro non-glycosylated CD162 protein mediated P-selectin related tumor metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CD162 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | SELPLG selectin P ligand [ Homo sapiens ] |
Official Symbol | SELPLG |
Synonyms | SELPLG; selectin P ligand; P-selectin glycoprotein ligand 1; CD162; PSGL 1; cutaneous lymphocyte-associated associated antigen; CLA; PSGL1; PSGL-1; |
Gene ID | 6404 |
mRNA Refseq | NM_001206609 |
Protein Refseq | NP_001193538 |
MIM | 600738 |
UniProt ID | Q14242 |
Chromosome Location | 12q24 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Staphylococcus aureus infection, organism-specific biosystem |
Function | bacterial cell surface binding; protein binding; receptor binding; |
◆ Recombinant Proteins | ||
SELPLG-1006H | Recombinant Human SELPLG protein, His & Avi-tagged | +Inquiry |
SELPLG-5034H | Recombinant Human SELPLG, His-tagged | +Inquiry |
Selplg-5747M | Recombinant Mouse Selplg Protein (Gln42-Cys307), C-Fc tagged | +Inquiry |
Selplg-7020M | Recombinant Mouse Selplg protein(Met1-Cys307), hFc-tagged | +Inquiry |
SELPLG-834H | Recombinant Human SELPLG protein(Met1-Val295), His&hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELPLG-001MCL | Recombinant Mouse SELPLG cell lysate | +Inquiry |
SELPLG-1089HCL | Recombinant Human SELPLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELPLG Products
Required fields are marked with *
My Review for All SELPLG Products
Required fields are marked with *