Recombinant Human SEMA3A protein, GST-tagged

Cat.No. : SEMA3A-3700H
Product Overview : Recombinant Human SEMA3A protein(140-235 aa), fused to GST tag, was expressed in E. coli.
Availability November 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 140-235 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SEMA3A sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A [ Homo sapiens ]
Official Symbol SEMA3A
Synonyms SEMA3A; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A; SEMAD; semaphorin-3A; coll 1; Hsema I; sema III; SEMA1; SemD; collapsin 1; semaphorin D; semaphorin L; semaphorin III; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III; MGC133243;
Gene ID 10371
mRNA Refseq NM_006080
Protein Refseq NP_006071
MIM 603961
UniProt ID Q14563

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEMA3A Products

Required fields are marked with *

My Review for All SEMA3A Products

Required fields are marked with *

0
cart-icon
0
compare icon