Recombinant Human SEMA3A protein, GST-tagged
| Cat.No. : | SEMA3A-3700H |
| Product Overview : | Recombinant Human SEMA3A protein(140-235 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 140-235 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SEMA3A sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A [ Homo sapiens ] |
| Official Symbol | SEMA3A |
| Synonyms | SEMA3A; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A; SEMAD; semaphorin-3A; coll 1; Hsema I; sema III; SEMA1; SemD; collapsin 1; semaphorin D; semaphorin L; semaphorin III; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III; MGC133243; |
| Gene ID | 10371 |
| mRNA Refseq | NM_006080 |
| Protein Refseq | NP_006071 |
| MIM | 603961 |
| UniProt ID | Q14563 |
| ◆ Recombinant Proteins | ||
| Sema3a-7972M | Recombinant Mouse Sema3a protein, His-tagged | +Inquiry |
| SEMA3A-1901H | Recombinant Human SEMA3A Protein, His-tagged | +Inquiry |
| SEMA3A-6536C | Recombinant Chicken SEMA3A | +Inquiry |
| SEMA3A-13H | Active Recombinant Human SEMA3A Protein, Met-6-His/Fc-tagged | +Inquiry |
| SEMA3A-0736H | Active Recombinant Human SEMA3A protein, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SEMA3A-1770MCL | Recombinant Mouse SEMA3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEMA3A Products
Required fields are marked with *
My Review for All SEMA3A Products
Required fields are marked with *
