Recombinant Human SEMA3A protein, GST-tagged

• Cat.No.: SEMA3A-3700H
• Product Overview: Recombinant Human SEMA3A protein(140-235 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 140-235 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SEMA3A sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A [ Homo sapiens ]
• Official Symbol: SEMA3A
• Synonyms: SEMA3A; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A; SEMAD; semaphorin-3A; coll 1; Hsema I; sema III; SEMA1; SemD; collapsin 1; semaphorin D; semaphorin L; semaphorin III; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III; MGC133243
• Gene ID: 10371
• mRNA Refseq: NM_006080
• Protein Refseq: NP_006071
• MIM: 603961
• UniProt ID: Q14563