Recombinant Human SEMA3A protein, His-tagged
Cat.No. : | SEMA3A-3850H |
Product Overview : | Recombinant Human SEMA3A protein(551-771 aa), fused to His tag, was expressed in E. coli. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 551-771 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RRTRRQDIRNGDPLTHCSDLHHDNHHGHSPEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEERKEEIRVDDHIIRTDQGLLLRSLQQKDSGNYLCHAVEHGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRRTHEFERAPRSV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SEMA3A sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A [ Homo sapiens ] |
Official Symbol | SEMA3A |
Synonyms | SEMA3A; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A; SEMAD; semaphorin-3A; coll 1; Hsema I; sema III; SEMA1; SemD; collapsin 1; semaphorin D; semaphorin L; semaphorin III; SEMAL; coll-1; Hsema-I; SEMAIII; Hsema-III; MGC133243; |
Gene ID | 10371 |
mRNA Refseq | NM_006080 |
Protein Refseq | NP_006071 |
MIM | 603961 |
UniProt ID | Q14563 |
◆ Recombinant Proteins | ||
SEMA3A-1902H | Recombinant Human SEMA3A protein, His-tagged | +Inquiry |
SEMA3A-854H | Recombinant Human SEMA3A, His-Flag-tagged | +Inquiry |
SEMA3A-1950R | Recombinant Rat SEMA3A Protein (21-772 aa), His-tagged | +Inquiry |
SEMA3A-13H | Active Recombinant Human SEMA3A Protein, Met-6-His/Fc-tagged | +Inquiry |
SEMA3A-852H | Recombinant Human SEMA3A protein, His/Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA3A-1770MCL | Recombinant Mouse SEMA3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEMA3A Products
Required fields are marked with *
My Review for All SEMA3A Products
Required fields are marked with *