Recombinant Human SEMA6D Protein, GST-tagged
Cat.No. : | SEMA6D-956H |
Product Overview : | Human SEMA6D partial ORF ( NP_705871.1, 852 a.a. - 940 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Several transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | KLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQMAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNS |
Gene Name | SEMA6D semaphorin 6D [ Homo sapiens (human) ] |
Official Symbol | SEMA6D |
Synonyms | FLJ11598,KIAA1479 |
Gene ID | 80031 |
mRNA Refseq | NM_153618 |
Protein Refseq | NP_705871.1 |
MIM | 609295 |
UniProt ID | Q8NFY4 |
◆ Recombinant Proteins | ||
SEMA6D-841H | Active Recombinant Human SEMA6D Protein, Fc Chimera | +Inquiry |
Sema6d-109M | Recombinant Mouse Sema6d Protein, His (Fc)-Avi-tagged | +Inquiry |
SEMA6D-140H | Recombinant Human SEMA6D Protein, His (Fc)-Avi-tagged | +Inquiry |
SEMA6D-12243Z | Recombinant Zebrafish SEMA6D | +Inquiry |
Sema6d-877M | Active Recombinant Mouse Sema6d Protein, Fc Chimera | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA6D-1583HCL | Recombinant Human SEMA6D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEMA6D Products
Required fields are marked with *
My Review for All SEMA6D Products
Required fields are marked with *