Recombinant Human SEMG1 Protein, His-tagged

Cat.No. : SEMG1-221H
Product Overview : Recombinant Human SEMG1, transcript variant 2, fused with His tag at C-terminal was expressed in HEK296 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : The protein encoded by this gene is the predominant protein in semen. The encoded secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. This preproprotein is proteolytically processed by the prostate-specific antigen (PSA) protease to generate multiple peptide products that exhibit distinct functions. One of these peptides, SgI-29, is an antimicrobial peptide with antibacterial activity. This proteolysis process also breaks down the gel matrix and allows the spermatozoa to move more freely. This gene and another similar semenogelin gene are present in a gene cluster on chromosome 20.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM Hac-NaAc, 150mM NaCl, pH 4.5
Molecular Mass : 43.8kD
AA Sequence : QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDQNPLFTVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name SEMG1 semenogelin I [ Homo sapiens ]
Official Symbol SEMG1
Synonyms SEMG1; semenogelin I; SEMG; semenogelin-1; cancer/testis antigen 103; CT103; semen coagulating protein; SGI; dJ172H20.2; FLJ78262; MGC14719;
Gene ID 6406
mRNA Refseq NM_003007
Protein Refseq NP_002998
MIM 182140
UniProt ID P04279

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEMG1 Products

Required fields are marked with *

My Review for All SEMG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon