Recombinant Human SENP2 protein, His-tagged

• Cat.No.: SENP2-6155H
• Product Overview: Recombinant Human SENP2 protein(78-228 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 78-228 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: TKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGH
• Purity: 80%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SENP2 SUMO1/sentrin/SMT3 specific peptidase 2 [ Homo sapiens ]
• Official Symbol: SENP2
• Synonyms: SENP2; SUMO1/sentrin/SMT3 specific peptidase 2; SUMO1/sentrin/SMT3 specific protease 2; sentrin-specific protease 2; AXAM2; DKFZp762A2316; KIAA1331; SMT3IP2; SMT3-specific isopeptidase 2; sentrin/SUMO-specific protease SENP2
• mRNA Refseq: NM_021627
• Protein Refseq: NP_067640
• MIM: 608261
• UniProt ID: Q9HC62
• Gene ID: 59343