Recombinant Human SEPP1 Protein (20-381 aa), His-tagged
Cat.No. : | SEPP1-802H |
Product Overview : | Recombinant Human SEPP1 Protein (20-381 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-381 aa |
Description : | Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 44.6 kDa |
AA Sequence : | ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | SEPP1 selenoprotein P, plasma, 1 [ Homo sapiens ] |
Official Symbol | SEPP1 |
Synonyms | SEPP1; selenoprotein P; SeP; SELP; |
Gene ID | 6414 |
mRNA Refseq | NM_001085486 |
Protein Refseq | NP_001078955 |
MIM | 601484 |
UniProt ID | P49908 |
◆ Recombinant Proteins | ||
SEPP1-14888M | Recombinant Mouse SEPP1 Protein | +Inquiry |
SEPP1-1513H | Recombinant Human SEPP1 Protein (20-381 aa), His-tagged | +Inquiry |
Sepp1-2051R | Recombinant Rat Sepp1 Protein, His-tagged | +Inquiry |
SEPP1-802H | Recombinant Human SEPP1 Protein (20-381 aa), His-tagged | +Inquiry |
SEPP1-8021M | Recombinant Mouse SEPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SEPP1 Products
Required fields are marked with *
My Review for All SEPP1 Products
Required fields are marked with *
0
Inquiry Basket