Recombinant Human SERF2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | SERF2-233H |
Product Overview : | SERF2 MS Standard C13 and N15-labeled recombinant protein (NP_001018118) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Positive regulator of amyloid protein aggregation and proteotoxicity (PubMed:20723760). Induces conformational changes in amyloid proteins, such as HTT, driving them into compact formations preceding the formation of aggregates. |
Molecular Mass : | 6.9 kDa |
AA Sequence : | MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SERF2 small EDRK-rich factor 2 [ Homo sapiens (human) ] |
Official Symbol | SERF2 |
Synonyms | SERF2; small EDRK-rich factor 2; small EDRK-rich factor 2; gastric cancer-related protein VRG107; protein 4F5-related |
Gene ID | 10169 |
mRNA Refseq | NM_001018108 |
Protein Refseq | NP_001018118 |
MIM | 605054 |
UniProt ID | P84101 |
◆ Recombinant Proteins | ||
SERF2-7475Z | Recombinant Zebrafish SERF2 | +Inquiry |
SERF2-286H | Recombinant Human small EDRK-rich factor 2, His-tagged | +Inquiry |
SERF2-2586H | Recombinant Human SERF2 protein, GST-tagged | +Inquiry |
SERF2-8033M | Recombinant Mouse SERF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERF2-14904M | Recombinant Mouse SERF2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERF2-1947HCL | Recombinant Human SERF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERF2 Products
Required fields are marked with *
My Review for All SERF2 Products
Required fields are marked with *
0
Inquiry Basket