Recombinant Human SERPINA12 Protein

Cat.No. : SERPINA12-16H
Product Overview : Recombinant human Vaspin (rhVaspin) produced in E. coli is a single non-glycosylated polypeptide chain containing 394 amino acids. rhVaspin has a molecular mass of 45.1kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 394 amino acids
Description : Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within negative regulation of gluconeogenesis; positive regulation of signal transduction; and regulation of lipid metabolic process. Predicted to be located in plasma membrane. Predicted to be active in extracellular space.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Bioassay data are not available.
Molecular Mass : 45.1 kDa, observed by reducing SDS-PAGE.
AA Sequence : LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Vaspin (rhVaspin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhVaspin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name SERPINA12 serpin family A member 12 [ Homo sapiens (human) ]
Official Symbol SERPINA12
Synonyms SERPINA12; serpin family A member 12; serpin A12; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; vaspin; visceral adipose tissue-derived serine protease inhibitor; visceral adipose-specific SERPIN
Gene ID 145264
mRNA Refseq NM_173850
Protein Refseq NP_776249
MIM 617471
UniProt ID Q8IW75

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINA12 Products

Required fields are marked with *

My Review for All SERPINA12 Products

Required fields are marked with *

0
cart-icon