Recombinant Human SERPINA12 Protein
Cat.No. : | SERPINA12-16H |
Product Overview : | Recombinant human Vaspin (rhVaspin) produced in E. coli is a single non-glycosylated polypeptide chain containing 394 amino acids. rhVaspin has a molecular mass of 45.1kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 394 amino acids |
Description : | Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within negative regulation of gluconeogenesis; positive regulation of signal transduction; and regulation of lipid metabolic process. Predicted to be located in plasma membrane. Predicted to be active in extracellular space. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Bioassay data are not available. |
Molecular Mass : | 45.1 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Vaspin (rhVaspin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhVaspin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | SERPINA12 serpin family A member 12 [ Homo sapiens (human) ] |
Official Symbol | SERPINA12 |
Synonyms | SERPINA12; serpin family A member 12; serpin A12; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; vaspin; visceral adipose tissue-derived serine protease inhibitor; visceral adipose-specific SERPIN |
Gene ID | 145264 |
mRNA Refseq | NM_173850 |
Protein Refseq | NP_776249 |
MIM | 617471 |
UniProt ID | Q8IW75 |
◆ Recombinant Proteins | ||
SERPINA12-3756H | Recombinant Human SERPINA12, His-tagged | +Inquiry |
SERPINA12-5674H | Recombinant Human SERPINA12 Protein (Leu21-Lys414), N-GST tagged | +Inquiry |
Serpina12-2441M | Recombinant Mouse Serpina12, FLAG-tagged | +Inquiry |
SERPINA12-31353TH | Recombinant Human SERPINA12, FLAG-tagged | +Inquiry |
Serpina12-693R | Recombinant Rat Serpina12 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA12-2050HCL | Recombinant Human SERPINA12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA12 Products
Required fields are marked with *
My Review for All SERPINA12 Products
Required fields are marked with *