Recombinant Human SERPINA12 Protein

• Cat.No.: SERPINA12-16H
• Product Overview: Recombinant human Vaspin (rhVaspin) produced in E. coli is a single non-glycosylated polypeptide chain containing 394 amino acids. rhVaspin has a molecular mass of 45.1kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 394 amino acids
• Description: Predicted to enable serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to act upstream of or within negative regulation of gluconeogenesis; positive regulation of signal transduction; and regulation of lipid metabolic process. Predicted to be located in plasma membrane. Predicted to be active in extracellular space.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Bioassay data are not available.
• Molecular Mass: 45.1 kDa, observed by reducing SDS-PAGE.
• AA Sequence: LKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGRNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFIDQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Vaspin (rhVaspin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhVaspin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: SERPINA12 serpin family A member 12 [ Homo sapiens (human) ]
• Official Symbol: SERPINA12
• Synonyms: SERPINA12; serpin family A member 12; serpin A12; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12; vaspin; visceral adipose tissue-derived serine protease inhibitor; visceral adipose-specific SERPIN
• Gene ID: 145264
• mRNA Refseq: NM_173850
• Protein Refseq: NP_776249
• MIM: 617471
• UniProt ID: Q8IW75