Recombinant Human SERPINB1

• Cat.No.: SERPINB1-31161TH
• Product Overview: Recombinant fragment corresponding to amino acids 201-300 of Human SERPINB1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Leukocyte elastase inhibitor (LEI) also known as serpin B1 is a protein that in humans is encoded by the SERPINB1 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
• Sequence Similarities: Belongs to the serpin family. Ov-serpin subfamily.

Gene Information

• Gene Name: SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ]
• Official Symbol: SERPINB1
• Synonyms: SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2
• Gene ID: 1992
• mRNA Refseq: NM_030666
• Protein Refseq: NP_109591
• MIM: 130135
• Uniprot ID: P30740
• Chromosome Location: 6p25
• Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem
• Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity