Recombinant Human SERPINB1
| Cat.No. : | SERPINB1-31161TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 201-300 of Human SERPINB1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | Leukocyte elastase inhibitor (LEI) also known as serpin B1 is a protein that in humans is encoded by the SERPINB1 gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS |
| Sequence Similarities : | Belongs to the serpin family. Ov-serpin subfamily. |
| Gene Name | SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ] |
| Official Symbol | SERPINB1 |
| Synonyms | SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2; |
| Gene ID | 1992 |
| mRNA Refseq | NM_030666 |
| Protein Refseq | NP_109591 |
| MIM | 130135 |
| Uniprot ID | P30740 |
| Chromosome Location | 6p25 |
| Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
| Function | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
| ◆ Recombinant Proteins | ||
| SERPINB1-857H | Recombinant Human SERPINB1 Protein, MYC/DDK-tagged | +Inquiry |
| SERPINB1-31161TH | Recombinant Human SERPINB1 | +Inquiry |
| SERPINB1-778H | Recombinant Human SERPINB1 Protein, His-tagged | +Inquiry |
| SERPINB1-4149R | Recombinant Rhesus monkey SERPINB1 Protein, His-tagged | +Inquiry |
| SerpinB1-3981H | Recombinant Human SerpinB1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB1 Products
Required fields are marked with *
My Review for All SERPINB1 Products
Required fields are marked with *
