Recombinant Human SERPINB1

Cat.No. : SERPINB1-31161TH
Product Overview : Recombinant fragment corresponding to amino acids 201-300 of Human SERPINB1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Leukocyte elastase inhibitor (LEI) also known as serpin B1 is a protein that in humans is encoded by the SERPINB1 gene.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSS
Sequence Similarities : Belongs to the serpin family. Ov-serpin subfamily.
Gene Name SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ]
Official Symbol SERPINB1
Synonyms SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2;
Gene ID 1992
mRNA Refseq NM_030666
Protein Refseq NP_109591
MIM 130135
Uniprot ID P30740
Chromosome Location 6p25
Pathway Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB1 Products

Required fields are marked with *

My Review for All SERPINB1 Products

Required fields are marked with *

0
cart-icon