Recombinant Human SERPINB4 protein(131-210 aa), C-His-tagged
Cat.No. : | SERPINB4-2774H |
Product Overview : | Recombinant Human SERPINB4 protein(P48594)(131-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131-210 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV |
Gene Name | SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 [ Homo sapiens ] |
Official Symbol | SERPINB4 |
Synonyms | SERPINB4; serpin peptidase inhibitor, clade B (ovalbumin), member 4; SCCA2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; serpin B4; LEUPIN; PI11; SCCA 2; SCCA1; squamous cell carcinoma antigen 2; PI-11; peptidase inhibitor 11; SCCA2/SCCA1 fusion protein; squamous cell carcinoma antigen 1; protease inhibitor (leucine-serpin); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; SCCA2; SCCA-2; |
Gene ID | 6318 |
mRNA Refseq | NM_002974 |
Protein Refseq | NP_002965 |
MIM | 600518 |
UniProt ID | P48594 |
◆ Recombinant Proteins | ||
SERPINB4-1763H | Recombinant Human SERPINB4 protein, His-tagged | +Inquiry |
SERPINB4-853H | Recombinant Human SERPINB4 Protein, MYC/DDK-tagged | +Inquiry |
SERPINB4-3482H | Recombinant Human SERPINB4 protein, His-SUMO-tagged | +Inquiry |
SERPINB4-211H | Recombinant Human SERPINB4 Protein, His-tagged | +Inquiry |
SERPINB4-6241H | Recombinant Human SERPINB4 Protein (Lys19-Val148), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB4-523HCL | Recombinant Human SERPINB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB4 Products
Required fields are marked with *
My Review for All SERPINB4 Products
Required fields are marked with *
0
Inquiry Basket