Recombinant Human SERPINB4 protein(131-210 aa), C-His-tagged

Cat.No. : SERPINB4-2774H
Product Overview : Recombinant Human SERPINB4 protein(P48594)(131-210 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 131-210 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV
Gene Name SERPINB4 serpin peptidase inhibitor, clade B (ovalbumin), member 4 [ Homo sapiens ]
Official Symbol SERPINB4
Synonyms SERPINB4; serpin peptidase inhibitor, clade B (ovalbumin), member 4; SCCA2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; serpin B4; LEUPIN; PI11; SCCA 2; SCCA1; squamous cell carcinoma antigen 2; PI-11; peptidase inhibitor 11; SCCA2/SCCA1 fusion protein; squamous cell carcinoma antigen 1; protease inhibitor (leucine-serpin); serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 4; SCCA2; SCCA-2;
Gene ID 6318
mRNA Refseq NM_002974
Protein Refseq NP_002965
MIM 600518
UniProt ID P48594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB4 Products

Required fields are marked with *

My Review for All SERPINB4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon